Anti CCL23 pAb (ATL-HPA042015)

Atlas Antibodies

SKU: ATL-HPA042015-25

• 

Protein Description: chemokine (C-C motif) ligand 23
Gene Name: CCL23
Alternative Gene Name: Ckb-8, CKb8, MIP-3, MPIF-1, SCYA23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018927: 28%, ENSRNOG00000057756: 26%
Entrez Gene ID: 6368
Uniprot ID: P55773
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NPVLLDMLWRRKIGPQMTLSHAAGFHATSADCCISYTPRSIPCSLLESYFETNS
• Gene Sequence: NPVLLDMLWRRKIGPQMTLSHAAGFHATSADCCISYTPRSIPCSLLESYFETNS
• Gene ID - Mouse: ENSMUSG00000018927
• Gene ID - Rat: ENSRNOG00000057756
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.