Anti CCL23 pAb (ATL-HPA042015)
Atlas Antibodies
- SKU:
- ATL-HPA042015-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CCL23
Alternative Gene Name: Ckb-8, CKb8, MIP-3, MPIF-1, SCYA23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018927: 28%, ENSRNOG00000057756: 26%
Entrez Gene ID: 6368
Uniprot ID: P55773
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NPVLLDMLWRRKIGPQMTLSHAAGFHATSADCCISYTPRSIPCSLLESYFETNS |
Gene Sequence | NPVLLDMLWRRKIGPQMTLSHAAGFHATSADCCISYTPRSIPCSLLESYFETNS |
Gene ID - Mouse | ENSMUSG00000018927 |
Gene ID - Rat | ENSRNOG00000057756 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CCL23 pAb (ATL-HPA042015) | |
Datasheet | Anti CCL23 pAb (ATL-HPA042015) Datasheet (External Link) |
Vendor Page | Anti CCL23 pAb (ATL-HPA042015) at Atlas Antibodies |
Documents & Links for Anti CCL23 pAb (ATL-HPA042015) | |
Datasheet | Anti CCL23 pAb (ATL-HPA042015) Datasheet (External Link) |
Vendor Page | Anti CCL23 pAb (ATL-HPA042015) |