Anti CCL23 pAb (ATL-HPA042015)

Atlas Antibodies

Catalog No.:
ATL-HPA042015-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chemokine (C-C motif) ligand 23
Gene Name: CCL23
Alternative Gene Name: Ckb-8, CKb8, MIP-3, MPIF-1, SCYA23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018927: 28%, ENSRNOG00000057756: 26%
Entrez Gene ID: 6368
Uniprot ID: P55773
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NPVLLDMLWRRKIGPQMTLSHAAGFHATSADCCISYTPRSIPCSLLESYFETNS
Gene Sequence NPVLLDMLWRRKIGPQMTLSHAAGFHATSADCCISYTPRSIPCSLLESYFETNS
Gene ID - Mouse ENSMUSG00000018927
Gene ID - Rat ENSRNOG00000057756
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCL23 pAb (ATL-HPA042015)
Datasheet Anti CCL23 pAb (ATL-HPA042015) Datasheet (External Link)
Vendor Page Anti CCL23 pAb (ATL-HPA042015) at Atlas Antibodies

Documents & Links for Anti CCL23 pAb (ATL-HPA042015)
Datasheet Anti CCL23 pAb (ATL-HPA042015) Datasheet (External Link)
Vendor Page Anti CCL23 pAb (ATL-HPA042015)