Anti CCL23 pAb (ATL-HPA042015)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042015-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CCL23
Alternative Gene Name: Ckb-8, CKb8, MIP-3, MPIF-1, SCYA23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018927: 28%, ENSRNOG00000057756: 26%
Entrez Gene ID: 6368
Uniprot ID: P55773
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NPVLLDMLWRRKIGPQMTLSHAAGFHATSADCCISYTPRSIPCSLLESYFETNS |
| Gene Sequence | NPVLLDMLWRRKIGPQMTLSHAAGFHATSADCCISYTPRSIPCSLLESYFETNS |
| Gene ID - Mouse | ENSMUSG00000018927 |
| Gene ID - Rat | ENSRNOG00000057756 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCL23 pAb (ATL-HPA042015) | |
| Datasheet | Anti CCL23 pAb (ATL-HPA042015) Datasheet (External Link) |
| Vendor Page | Anti CCL23 pAb (ATL-HPA042015) at Atlas Antibodies |
| Documents & Links for Anti CCL23 pAb (ATL-HPA042015) | |
| Datasheet | Anti CCL23 pAb (ATL-HPA042015) Datasheet (External Link) |
| Vendor Page | Anti CCL23 pAb (ATL-HPA042015) |