Anti CCL21 pAb (ATL-HPA051210 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051210-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CCL21
Alternative Gene Name: 6Ckine, CKb9, ECL, exodus-2, SCYA21, SLC, TCA4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096271: 65%, ENSRNOG00000034290: 60%
Entrez Gene ID: 6366
Uniprot ID: O00585
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQT |
| Gene Sequence | KELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQT |
| Gene ID - Mouse | ENSMUSG00000096271 |
| Gene ID - Rat | ENSRNOG00000034290 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCL21 pAb (ATL-HPA051210 w/enhanced validation) | |
| Datasheet | Anti CCL21 pAb (ATL-HPA051210 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CCL21 pAb (ATL-HPA051210 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CCL21 pAb (ATL-HPA051210 w/enhanced validation) | |
| Datasheet | Anti CCL21 pAb (ATL-HPA051210 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CCL21 pAb (ATL-HPA051210 w/enhanced validation) |
| Citations for Anti CCL21 pAb (ATL-HPA051210 w/enhanced validation) – 4 Found |
| Sand, Laurens G L; Berghuis, Dagmar; Szuhai, Karoly; Hogendoorn, Pancras C W. Expression of CCL21 in Ewing sarcoma shows an inverse correlation with metastases and is a candidate target for immunotherapy. Cancer Immunology, Immunotherapy : Cii. 2016;65(8):995-1002. PubMed |
| Andersson, Sandra; Nilsson, Kenneth; Fagerberg, Linn; Hallström, Björn M; Sundström, Christer; Danielsson, Angelika; Edlund, Karolina; Uhlen, Mathias; Asplund, Anna. The transcriptomic and proteomic landscapes of bone marrow and secondary lymphoid tissues. Plos One. 9(12):e115911. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
| Hale, Laura P; Cheatham, Lynn; Macintyre, Andrew N; LaFleur, Bonnie; Sanders, Brittany; Troy, Jesse; Kurtzberg, Joanne; Sempowski, Gregory D. T cell-depleted cultured pediatric thymus tissue as a model for some aspects of human age-related thymus involution. Geroscience. 2021;43(3):1369-1382. PubMed |