Anti CCL14 pAb (ATL-HPA030268)

Atlas Antibodies

Catalog No.:
ATL-HPA030268-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chemokine (C-C motif) ligand 14
Gene Name: CCL14
Alternative Gene Name: CKb1, HCC-1, HCC-3, MCIF, NCC-2, SCYA14, SCYL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018930: 47%, ENSRNOG00000011406: 45%
Entrez Gene ID: 6358
Uniprot ID: Q16627
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKE
Gene Sequence TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKE
Gene ID - Mouse ENSMUSG00000018930
Gene ID - Rat ENSRNOG00000011406
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCL14 pAb (ATL-HPA030268)
Datasheet Anti CCL14 pAb (ATL-HPA030268) Datasheet (External Link)
Vendor Page Anti CCL14 pAb (ATL-HPA030268) at Atlas Antibodies

Documents & Links for Anti CCL14 pAb (ATL-HPA030268)
Datasheet Anti CCL14 pAb (ATL-HPA030268) Datasheet (External Link)
Vendor Page Anti CCL14 pAb (ATL-HPA030268)