Anti CCL14 pAb (ATL-HPA030268)

Atlas Antibodies

Catalog No.: ATL-HPA030268-25

Protein Description: chemokine (C-C motif) ligand 14
Gene Name: CCL14
Alternative Gene Name: CKb1, HCC-1, HCC-3, MCIF, NCC-2, SCYA14, SCYL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018930: 47%, ENSRNOG00000011406: 45%
Entrez Gene ID: 6358
Uniprot ID: Q16627
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKE
• Gene Sequence: TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKE
• Gene ID - Mouse: ENSMUSG00000018930
• Gene ID - Rat: ENSRNOG00000011406
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.