Anti CCK pAb (ATL-HPA069515 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA069515-25
  • Immunohistochemistry analysis in human duodenum and skeletal muscle tissues using HPA069515 antibody. Corresponding CCK RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.
Adding to cart… The item has been added
Protein Description: cholecystokinin
Gene Name: CCK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032532: 84%, ENSRNOG00000019321: 82%
Entrez Gene ID: 885
Uniprot ID: P06307
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMG
Gene Sequence LQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMG
Gene ID - Mouse ENSMUSG00000032532
Gene ID - Rat ENSRNOG00000019321
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCK pAb (ATL-HPA069515 w/enhanced validation)
Datasheet Anti CCK pAb (ATL-HPA069515 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCK pAb (ATL-HPA069515 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CCK pAb (ATL-HPA069515 w/enhanced validation)
Datasheet Anti CCK pAb (ATL-HPA069515 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCK pAb (ATL-HPA069515 w/enhanced validation)