Anti CCHCR1 pAb (ATL-HPA054167)

Atlas Antibodies

Catalog No.:
ATL-HPA054167-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: coiled-coil alpha-helical rod protein 1
Gene Name: CCHCR1
Alternative Gene Name: C6orf18, HCR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040312: 74%, ENSRNOG00000050233: 72%
Entrez Gene ID: 54535
Uniprot ID: Q8TD31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SEVHSQTWELERQKLLETMQHLQEDRDSLHATAELLQVRVQSLTHILALQEEELTRKVQPSDSLEPEFTRKCQSLLNRWREKVFALMVQLKAQELEHSDS
Gene Sequence SEVHSQTWELERQKLLETMQHLQEDRDSLHATAELLQVRVQSLTHILALQEEELTRKVQPSDSLEPEFTRKCQSLLNRWREKVFALMVQLKAQELEHSDS
Gene ID - Mouse ENSMUSG00000040312
Gene ID - Rat ENSRNOG00000050233
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCHCR1 pAb (ATL-HPA054167)
Datasheet Anti CCHCR1 pAb (ATL-HPA054167) Datasheet (External Link)
Vendor Page Anti CCHCR1 pAb (ATL-HPA054167) at Atlas Antibodies

Documents & Links for Anti CCHCR1 pAb (ATL-HPA054167)
Datasheet Anti CCHCR1 pAb (ATL-HPA054167) Datasheet (External Link)
Vendor Page Anti CCHCR1 pAb (ATL-HPA054167)