Anti CCDC93 pAb (ATL-HPA054183)

Atlas Antibodies

Catalog No.:
ATL-HPA054183-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 93
Gene Name: CCDC93
Alternative Gene Name: FLJ10996
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026339: 88%, ENSRNOG00000002514: 91%
Entrez Gene ID: 54520
Uniprot ID: Q567U6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGMDFIHIFPVVQWLVKRAIETKEEMGDYIRSYSVSQFQKTYSLPEDDDFIKRKEKAIKTVVDLSEVYKPRRKYKRHQGAEELLDEESRIHATLLEYG
Gene Sequence QGMDFIHIFPVVQWLVKRAIETKEEMGDYIRSYSVSQFQKTYSLPEDDDFIKRKEKAIKTVVDLSEVYKPRRKYKRHQGAEELLDEESRIHATLLEYG
Gene ID - Mouse ENSMUSG00000026339
Gene ID - Rat ENSRNOG00000002514
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC93 pAb (ATL-HPA054183)
Datasheet Anti CCDC93 pAb (ATL-HPA054183) Datasheet (External Link)
Vendor Page Anti CCDC93 pAb (ATL-HPA054183) at Atlas Antibodies

Documents & Links for Anti CCDC93 pAb (ATL-HPA054183)
Datasheet Anti CCDC93 pAb (ATL-HPA054183) Datasheet (External Link)
Vendor Page Anti CCDC93 pAb (ATL-HPA054183)