Anti CCDC91 pAb (ATL-HPA038169)

Atlas Antibodies

SKU: ATL-HPA038169-25

• 
• 
• 

Protein Description: coiled-coil domain containing 91
Gene Name: CCDC91
Alternative Gene Name: DKFZp779L1558, FLJ11088, p56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030301: 70%, ENSRNOG00000001847: 69%
Entrez Gene ID: 55297
Uniprot ID: Q7Z6B0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDDDDFGGFEAAETFDGGSGETQTTSPAIPWAAFPAVSGVHLSPSSPEIVLDRDHSSSIGCLSSDAIISSPENTHAANSIVSQTIPKAQ
• Gene Sequence: MDDDDFGGFEAAETFDGGSGETQTTSPAIPWAAFPAVSGVHLSPSSPEIVLDRDHSSSIGCLSSDAIISSPENTHAANSIVSQTIPKAQ
• Gene ID - Mouse: ENSMUSG00000030301
• Gene ID - Rat: ENSRNOG00000001847
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.