Anti CCDC90B pAb (ATL-HPA011130)

Atlas Antibodies

SKU:
ATL-HPA011130-100
  • Immunohistochemical staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
  • Western blot analysis in human testis tissue.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 90B
Gene Name: CCDC90B
Alternative Gene Name: MDS011, MDS025
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030613: 92%, ENSRNOG00000009462: 92%
Entrez Gene ID: 60492
Uniprot ID: Q9GZT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AHLDAIRKDMVILEKSEFANLRAENEKMKIELDQVKQQLMHETSRIRADNKLDINLERSRVTDMFTDQEKQLMETTTEFTKKDTQTKSIISETSNKIDAEIASLKTLMESNKLE
Gene Sequence AHLDAIRKDMVILEKSEFANLRAENEKMKIELDQVKQQLMHETSRIRADNKLDINLERSRVTDMFTDQEKQLMETTTEFTKKDTQTKSIISETSNKIDAEIASLKTLMESNKLE
Gene ID - Mouse ENSMUSG00000030613
Gene ID - Rat ENSRNOG00000009462
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC90B pAb (ATL-HPA011130)
Datasheet Anti CCDC90B pAb (ATL-HPA011130) Datasheet (External Link)
Vendor Page Anti CCDC90B pAb (ATL-HPA011130) at Atlas Antibodies

Documents & Links for Anti CCDC90B pAb (ATL-HPA011130)
Datasheet Anti CCDC90B pAb (ATL-HPA011130) Datasheet (External Link)
Vendor Page Anti CCDC90B pAb (ATL-HPA011130)



Citations for Anti CCDC90B pAb (ATL-HPA011130) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed