Anti CCDC85C pAb (ATL-HPA058346)

Atlas Antibodies

Catalog No.:
ATL-HPA058346-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 85C
Gene Name: CCDC85C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000084883: 95%, ENSRNOG00000051719: 95%
Entrez Gene ID: 317762
Uniprot ID: A6NKD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSAGYSPAGQKPEAVVHAMKVLEVHENLDRQLQDSCEEDLSEKEKAIVREMCNVVWR
Gene Sequence PSAGYSPAGQKPEAVVHAMKVLEVHENLDRQLQDSCEEDLSEKEKAIVREMCNVVWR
Gene ID - Mouse ENSMUSG00000084883
Gene ID - Rat ENSRNOG00000051719
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC85C pAb (ATL-HPA058346)
Datasheet Anti CCDC85C pAb (ATL-HPA058346) Datasheet (External Link)
Vendor Page Anti CCDC85C pAb (ATL-HPA058346) at Atlas Antibodies

Documents & Links for Anti CCDC85C pAb (ATL-HPA058346)
Datasheet Anti CCDC85C pAb (ATL-HPA058346) Datasheet (External Link)
Vendor Page Anti CCDC85C pAb (ATL-HPA058346)