Anti CCDC85B pAb (ATL-HPA054415)

Atlas Antibodies

Catalog No.:
ATL-HPA054415-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 85B
Gene Name: CCDC85B
Alternative Gene Name: DIPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095098: 100%, ENSRNOG00000061046: 38%
Entrez Gene ID: 11007
Uniprot ID: Q15834
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARQWQLFGTQASRAVREDLGGCWQKLAELEGRQEELLRE
Gene Sequence ARQWQLFGTQASRAVREDLGGCWQKLAELEGRQEELLRE
Gene ID - Mouse ENSMUSG00000095098
Gene ID - Rat ENSRNOG00000061046
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC85B pAb (ATL-HPA054415)
Datasheet Anti CCDC85B pAb (ATL-HPA054415) Datasheet (External Link)
Vendor Page Anti CCDC85B pAb (ATL-HPA054415) at Atlas Antibodies

Documents & Links for Anti CCDC85B pAb (ATL-HPA054415)
Datasheet Anti CCDC85B pAb (ATL-HPA054415) Datasheet (External Link)
Vendor Page Anti CCDC85B pAb (ATL-HPA054415)