Anti CCDC85A pAb (ATL-HPA043106)

Atlas Antibodies

Catalog No.:
ATL-HPA043106-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 85A
Gene Name: CCDC85A
Alternative Gene Name: KIAA1912
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032878: 92%, ENSRNOG00000003374: 93%
Entrez Gene ID: 114800
Uniprot ID: Q96PX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RHPHPGSSPETLPKHVLSGSPEHFQKHRSGSSPEHARHSGGSPEHLQKHALGGSLEHLPRARGTSPEHLKQHYGGSPDHKHGGGSGGS
Gene Sequence RHPHPGSSPETLPKHVLSGSPEHFQKHRSGSSPEHARHSGGSPEHLQKHALGGSLEHLPRARGTSPEHLKQHYGGSPDHKHGGGSGGS
Gene ID - Mouse ENSMUSG00000032878
Gene ID - Rat ENSRNOG00000003374
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC85A pAb (ATL-HPA043106)
Datasheet Anti CCDC85A pAb (ATL-HPA043106) Datasheet (External Link)
Vendor Page Anti CCDC85A pAb (ATL-HPA043106) at Atlas Antibodies

Documents & Links for Anti CCDC85A pAb (ATL-HPA043106)
Datasheet Anti CCDC85A pAb (ATL-HPA043106) Datasheet (External Link)
Vendor Page Anti CCDC85A pAb (ATL-HPA043106)