Anti CCDC84 pAb (ATL-HPA039906 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA039906-25
  • Immunohistochemical staining of human uterus, pre-menopause shows strong cytoplasmic positivity in glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CCDC84 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY404922).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 84
Gene Name: CCDC84
Alternative Gene Name: DLNB14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043923: 84%, ENSRNOG00000012137: 82%
Entrez Gene ID: 338657
Uniprot ID: Q86UT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEKFLVTPQDYARFKKSMVKGLDSYEEKEDKVIKEMAAQIREVEQSRQEVVRSVLEPQAVPDPEEGSSAPRSWKGMNSQVASSLQQPSNLDLPP
Gene Sequence KEKFLVTPQDYARFKKSMVKGLDSYEEKEDKVIKEMAAQIREVEQSRQEVVRSVLEPQAVPDPEEGSSAPRSWKGMNSQVASSLQQPSNLDLPP
Gene ID - Mouse ENSMUSG00000043923
Gene ID - Rat ENSRNOG00000012137
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CCDC84 pAb (ATL-HPA039906 w/enhanced validation)
Datasheet Anti CCDC84 pAb (ATL-HPA039906 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCDC84 pAb (ATL-HPA039906 w/enhanced validation)