Anti CCDC84 pAb (ATL-HPA039906 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039906-25

Protein Description: coiled-coil domain containing 84
Gene Name: CCDC84
Alternative Gene Name: DLNB14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043923: 84%, ENSRNOG00000012137: 82%
Entrez Gene ID: 338657
Uniprot ID: Q86UT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEKFLVTPQDYARFKKSMVKGLDSYEEKEDKVIKEMAAQIREVEQSRQEVVRSVLEPQAVPDPEEGSSAPRSWKGMNSQVASSLQQPSNLDLPP
• Gene Sequence: KEKFLVTPQDYARFKKSMVKGLDSYEEKEDKVIKEMAAQIREVEQSRQEVVRSVLEPQAVPDPEEGSSAPRSWKGMNSQVASSLQQPSNLDLPP
• Gene ID - Mouse: ENSMUSG00000043923
• Gene ID - Rat: ENSRNOG00000012137
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.