Anti CCDC81 pAb (ATL-HPA040745)

Atlas Antibodies

SKU:
ATL-HPA040745-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells of tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 81
Gene Name: CCDC81
Alternative Gene Name: FLJ16339, FLJ23514
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039391: 83%, ENSRNOG00000033733: 63%
Entrez Gene ID: 60494
Uniprot ID: Q6ZN84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NHKNEKPEFYKSFLFDKRPLSPALNALKQEEYSRSLLKQMDNRQENEIKQRQYRELMDRLEQVQLTEELAAQRAKFLKDKMEETQCYKRALDAQIKNKPSRL
Gene Sequence NHKNEKPEFYKSFLFDKRPLSPALNALKQEEYSRSLLKQMDNRQENEIKQRQYRELMDRLEQVQLTEELAAQRAKFLKDKMEETQCYKRALDAQIKNKPSRL
Gene ID - Mouse ENSMUSG00000039391
Gene ID - Rat ENSRNOG00000033733
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC81 pAb (ATL-HPA040745)
Datasheet Anti CCDC81 pAb (ATL-HPA040745) Datasheet (External Link)
Vendor Page Anti CCDC81 pAb (ATL-HPA040745) at Atlas Antibodies

Documents & Links for Anti CCDC81 pAb (ATL-HPA040745)
Datasheet Anti CCDC81 pAb (ATL-HPA040745) Datasheet (External Link)
Vendor Page Anti CCDC81 pAb (ATL-HPA040745)