Anti CCDC80 pAb (ATL-HPA002266)

Atlas Antibodies

SKU: ATL-HPA002266-25

• 

Protein Description: coiled-coil domain containing 80
Gene Name: CCDC80
Alternative Gene Name: DRO1, SSG1, URB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022665: 95%, ENSRNOG00000002052: 95%
Entrez Gene ID: 151887
Uniprot ID: Q76M96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MMSLLKDDVYCELAERHIQQIVLFHQAGEEGGKVRRITSEGQILEQPLDPSLIPKLMSFLKLEKGKFGMVLLKKTLQVEERYPYPVRLEAMYEVIDQGPIRRIEKIRQKGFVQKCKASGVEGQVVAEGNDGGG
• Gene Sequence: MMSLLKDDVYCELAERHIQQIVLFHQAGEEGGKVRRITSEGQILEQPLDPSLIPKLMSFLKLEKGKFGMVLLKKTLQVEERYPYPVRLEAMYEVIDQGPIRRIEKIRQKGFVQKCKASGVEGQVVAEGNDGGG
• Gene ID - Mouse: ENSMUSG00000022665
• Gene ID - Rat: ENSRNOG00000002052
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CCDC80 pAb (ATL-HPA002266) – 2 Found

Asplund, A; Gry Björklund, M; Sundquist, C; Strömberg, S; Edlund, K; Ostman, A; Nilsson, P; Pontén, F; Lundeberg, J. Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma. The British Journal Of Dermatology. 2008;158(3):527-38. 

Chan, Siu Chiu; Zhang, Ying; Pontoglio, Marco; Igarashi, Peter. Hepatocyte nuclear factor-1β regulates Wnt signaling through genome-wide competition with β-catenin/lymphoid enhancer binding factor. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2019;116(48):24133-24142.