Anti CCDC80 pAb (ATL-HPA002266)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002266-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CCDC80
Alternative Gene Name: DRO1, SSG1, URB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022665: 95%, ENSRNOG00000002052: 95%
Entrez Gene ID: 151887
Uniprot ID: Q76M96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MMSLLKDDVYCELAERHIQQIVLFHQAGEEGGKVRRITSEGQILEQPLDPSLIPKLMSFLKLEKGKFGMVLLKKTLQVEERYPYPVRLEAMYEVIDQGPIRRIEKIRQKGFVQKCKASGVEGQVVAEGNDGGG |
| Gene Sequence | MMSLLKDDVYCELAERHIQQIVLFHQAGEEGGKVRRITSEGQILEQPLDPSLIPKLMSFLKLEKGKFGMVLLKKTLQVEERYPYPVRLEAMYEVIDQGPIRRIEKIRQKGFVQKCKASGVEGQVVAEGNDGGG |
| Gene ID - Mouse | ENSMUSG00000022665 |
| Gene ID - Rat | ENSRNOG00000002052 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCDC80 pAb (ATL-HPA002266) | |
| Datasheet | Anti CCDC80 pAb (ATL-HPA002266) Datasheet (External Link) |
| Vendor Page | Anti CCDC80 pAb (ATL-HPA002266) at Atlas Antibodies |
| Documents & Links for Anti CCDC80 pAb (ATL-HPA002266) | |
| Datasheet | Anti CCDC80 pAb (ATL-HPA002266) Datasheet (External Link) |
| Vendor Page | Anti CCDC80 pAb (ATL-HPA002266) |
| Citations for Anti CCDC80 pAb (ATL-HPA002266) – 2 Found |
| Asplund, A; Gry Björklund, M; Sundquist, C; Strömberg, S; Edlund, K; Ostman, A; Nilsson, P; Pontén, F; Lundeberg, J. Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma. The British Journal Of Dermatology. 2008;158(3):527-38. PubMed |
| Chan, Siu Chiu; Zhang, Ying; Pontoglio, Marco; Igarashi, Peter. Hepatocyte nuclear factor-1β regulates Wnt signaling through genome-wide competition with β-catenin/lymphoid enhancer binding factor. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2019;116(48):24133-24142. PubMed |