Anti CCDC77 pAb (ATL-HPA038854)

Atlas Antibodies

SKU:
ATL-HPA038854-25
  • Immunohistochemical staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line A-431 shows localization to nuclear membrane.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 77
Gene Name: CCDC77
Alternative Gene Name: MGC13183
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030177: 85%, ENSRNOG00000037206: 84%
Entrez Gene ID: 84318
Uniprot ID: Q9BR77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IMTKRYEALERRRILEVEGFKTDIKVLRQKLKDLEQMLYKATVNARANQDLALLCEVRDSNRRAHKIQGELKNLKSKVFGLENEL
Gene Sequence IMTKRYEALERRRILEVEGFKTDIKVLRQKLKDLEQMLYKATVNARANQDLALLCEVRDSNRRAHKIQGELKNLKSKVFGLENEL
Gene ID - Mouse ENSMUSG00000030177
Gene ID - Rat ENSRNOG00000037206
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC77 pAb (ATL-HPA038854)
Datasheet Anti CCDC77 pAb (ATL-HPA038854) Datasheet (External Link)
Vendor Page Anti CCDC77 pAb (ATL-HPA038854) at Atlas Antibodies

Documents & Links for Anti CCDC77 pAb (ATL-HPA038854)
Datasheet Anti CCDC77 pAb (ATL-HPA038854) Datasheet (External Link)
Vendor Page Anti CCDC77 pAb (ATL-HPA038854)