Anti CCDC73 pAb (ATL-HPA038669)

Atlas Antibodies

SKU:
ATL-HPA038669-25
  • Immunohistochemical staining of human kidney shows strong luminal membranous positivity in cells in tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 73
Gene Name: CCDC73
Alternative Gene Name: NY-SAR-79
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045106: 35%, ENSRNOG00000022660: 32%
Entrez Gene ID: 493860
Uniprot ID: Q6ZRK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTVPCDIVIDHHVSYAAFSANSKLLLKNSDKNVHSMSMLVKPNSSPGGKTMCKNMSDMQNSQFNNCLGYLENTNVNISHLHLNNENSHASQAKDVKTA
Gene Sequence LTVPCDIVIDHHVSYAAFSANSKLLLKNSDKNVHSMSMLVKPNSSPGGKTMCKNMSDMQNSQFNNCLGYLENTNVNISHLHLNNENSHASQAKDVKTA
Gene ID - Mouse ENSMUSG00000045106
Gene ID - Rat ENSRNOG00000022660
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC73 pAb (ATL-HPA038669)
Datasheet Anti CCDC73 pAb (ATL-HPA038669) Datasheet (External Link)
Vendor Page Anti CCDC73 pAb (ATL-HPA038669) at Atlas Antibodies

Documents & Links for Anti CCDC73 pAb (ATL-HPA038669)
Datasheet Anti CCDC73 pAb (ATL-HPA038669) Datasheet (External Link)
Vendor Page Anti CCDC73 pAb (ATL-HPA038669)