Anti CCDC7 pAb (ATL-HPA075536)

Atlas Antibodies

Catalog No.:
ATL-HPA075536-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 7
Gene Name: CCDC7
Alternative Gene Name: BIOT2, C10orf68, FLJ13031, FLJ32762
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056018: 40%, ENSRNOG00000050191: 42%
Entrez Gene ID: 79741
Uniprot ID: Q96M83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKSSVKVMLSKTMDKENRPEAVKSCEALAQKIEEFLEAHSTDEFKDVSATEPQTAHSMTNRFNAMLKVFENQ
Gene Sequence SKSSVKVMLSKTMDKENRPEAVKSCEALAQKIEEFLEAHSTDEFKDVSATEPQTAHSMTNRFNAMLKVFENQ
Gene ID - Mouse ENSMUSG00000056018
Gene ID - Rat ENSRNOG00000050191
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC7 pAb (ATL-HPA075536)
Datasheet Anti CCDC7 pAb (ATL-HPA075536) Datasheet (External Link)
Vendor Page Anti CCDC7 pAb (ATL-HPA075536) at Atlas Antibodies

Documents & Links for Anti CCDC7 pAb (ATL-HPA075536)
Datasheet Anti CCDC7 pAb (ATL-HPA075536) Datasheet (External Link)
Vendor Page Anti CCDC7 pAb (ATL-HPA075536)