Anti CCDC69 pAb (ATL-HPA052896)

Atlas Antibodies

Catalog No.:
ATL-HPA052896-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 69
Gene Name: CCDC69
Alternative Gene Name: DKFZP434C171, FLJ13705
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019892: 30%, ENSRNOG00000018524: 30%
Entrez Gene ID: 26112
Uniprot ID: A6NI79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPHELGPLNGDTAITVQLCASEEAERHQKDITRILQQHEEEKKKWAQQVEKERELELRDRLDEQQRVLEGKNEEALQVLRA
Gene Sequence EPHELGPLNGDTAITVQLCASEEAERHQKDITRILQQHEEEKKKWAQQVEKERELELRDRLDEQQRVLEGKNEEALQVLRA
Gene ID - Mouse ENSMUSG00000019892
Gene ID - Rat ENSRNOG00000018524
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC69 pAb (ATL-HPA052896)
Datasheet Anti CCDC69 pAb (ATL-HPA052896) Datasheet (External Link)
Vendor Page Anti CCDC69 pAb (ATL-HPA052896) at Atlas Antibodies

Documents & Links for Anti CCDC69 pAb (ATL-HPA052896)
Datasheet Anti CCDC69 pAb (ATL-HPA052896) Datasheet (External Link)
Vendor Page Anti CCDC69 pAb (ATL-HPA052896)