Anti CCDC69 pAb (ATL-HPA043648)

Atlas Antibodies

SKU:
ATL-HPA043648-25
  • Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 69
Gene Name: CCDC69
Alternative Gene Name: DKFZP434C171, FLJ13705
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049588: 59%, ENSRNOG00000021370: 58%
Entrez Gene ID: 26112
Uniprot ID: A6NI79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen THSFREASSTQQETIDRLTSQLEAFQAKMKRVEESILSRNYKKHIQDYGSPSQFWEQELESLHFVIEMKNERIHELDRRLILMETV
Gene Sequence THSFREASSTQQETIDRLTSQLEAFQAKMKRVEESILSRNYKKHIQDYGSPSQFWEQELESLHFVIEMKNERIHELDRRLILMETV
Gene ID - Mouse ENSMUSG00000049588
Gene ID - Rat ENSRNOG00000021370
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC69 pAb (ATL-HPA043648)
Datasheet Anti CCDC69 pAb (ATL-HPA043648) Datasheet (External Link)
Vendor Page Anti CCDC69 pAb (ATL-HPA043648) at Atlas Antibodies

Documents & Links for Anti CCDC69 pAb (ATL-HPA043648)
Datasheet Anti CCDC69 pAb (ATL-HPA043648) Datasheet (External Link)
Vendor Page Anti CCDC69 pAb (ATL-HPA043648)