Anti CCDC68 pAb (ATL-HPA040865)

Atlas Antibodies

Catalog No.: ATL-HPA040865-25

Protein Description: coiled-coil domain containing 68
Gene Name: CCDC68
Alternative Gene Name: SE57-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038903: 73%, ENSRNOG00000021381: 33%
Entrez Gene ID: 80323
Uniprot ID: Q9H2F9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QKLKQHVENLNQVAEKLEEKHSQITELENLVQRMEKEKRTLLERKLSLENKLLQLKSSATYGKSCQDLQREISILQEQISHLQF
• Gene Sequence: QKLKQHVENLNQVAEKLEEKHSQITELENLVQRMEKEKRTLLERKLSLENKLLQLKSSATYGKSCQDLQREISILQEQISHLQF
• Gene ID - Mouse: ENSMUSG00000038903
• Gene ID - Rat: ENSRNOG00000021381
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.