Anti CCDC68 pAb (ATL-HPA040865)

Atlas Antibodies

SKU:
ATL-HPA040865-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 68
Gene Name: CCDC68
Alternative Gene Name: SE57-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038903: 73%, ENSRNOG00000021381: 33%
Entrez Gene ID: 80323
Uniprot ID: Q9H2F9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QKLKQHVENLNQVAEKLEEKHSQITELENLVQRMEKEKRTLLERKLSLENKLLQLKSSATYGKSCQDLQREISILQEQISHLQF
Gene Sequence QKLKQHVENLNQVAEKLEEKHSQITELENLVQRMEKEKRTLLERKLSLENKLLQLKSSATYGKSCQDLQREISILQEQISHLQF
Gene ID - Mouse ENSMUSG00000038903
Gene ID - Rat ENSRNOG00000021381
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC68 pAb (ATL-HPA040865)
Datasheet Anti CCDC68 pAb (ATL-HPA040865) Datasheet (External Link)
Vendor Page Anti CCDC68 pAb (ATL-HPA040865) at Atlas Antibodies

Documents & Links for Anti CCDC68 pAb (ATL-HPA040865)
Datasheet Anti CCDC68 pAb (ATL-HPA040865) Datasheet (External Link)
Vendor Page Anti CCDC68 pAb (ATL-HPA040865)