Anti CCDC66 pAb (ATL-HPA051937)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051937-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CCDC66
Alternative Gene Name: DKFZp686C0433
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046753: 52%, ENSRNOG00000028380: 52%
Entrez Gene ID: 285331
Uniprot ID: A2RUB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QKGHDTSRLIKNLGVDTIQMEYNASNISNSRHDSDEISGKMNTYMNSTTSKKDTGVQTDDLNIGIFTNAESHCGSLMERDITNCSSPEISAELI |
Gene Sequence | QKGHDTSRLIKNLGVDTIQMEYNASNISNSRHDSDEISGKMNTYMNSTTSKKDTGVQTDDLNIGIFTNAESHCGSLMERDITNCSSPEISAELI |
Gene ID - Mouse | ENSMUSG00000046753 |
Gene ID - Rat | ENSRNOG00000028380 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CCDC66 pAb (ATL-HPA051937) | |
Datasheet | Anti CCDC66 pAb (ATL-HPA051937) Datasheet (External Link) |
Vendor Page | Anti CCDC66 pAb (ATL-HPA051937) at Atlas Antibodies |
Documents & Links for Anti CCDC66 pAb (ATL-HPA051937) | |
Datasheet | Anti CCDC66 pAb (ATL-HPA051937) Datasheet (External Link) |
Vendor Page | Anti CCDC66 pAb (ATL-HPA051937) |