Anti CCDC65 pAb (ATL-HPA057573)

Atlas Antibodies

Catalog No.:
ATL-HPA057573-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 65
Gene Name: CCDC65
Alternative Gene Name: CFAP250, CILD27, DRC2, FAP250, FLJ35732, NYD-SP28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003354: 88%, ENSRNOG00000058916: 85%
Entrez Gene ID: 85478
Uniprot ID: Q8IXS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MELEALTKEFETERKTIIDQHEKEIHYLQDIFMAMEQNYIDSEYESKLEFQSMWNDLKNMNLEEKHFLRLHLENRVEDLWRKFQDVLKNYTDAT
Gene Sequence MELEALTKEFETERKTIIDQHEKEIHYLQDIFMAMEQNYIDSEYESKLEFQSMWNDLKNMNLEEKHFLRLHLENRVEDLWRKFQDVLKNYTDAT
Gene ID - Mouse ENSMUSG00000003354
Gene ID - Rat ENSRNOG00000058916
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC65 pAb (ATL-HPA057573)
Datasheet Anti CCDC65 pAb (ATL-HPA057573) Datasheet (External Link)
Vendor Page Anti CCDC65 pAb (ATL-HPA057573) at Atlas Antibodies

Documents & Links for Anti CCDC65 pAb (ATL-HPA057573)
Datasheet Anti CCDC65 pAb (ATL-HPA057573) Datasheet (External Link)
Vendor Page Anti CCDC65 pAb (ATL-HPA057573)