Anti CCDC65 pAb (ATL-HPA038520)

Atlas Antibodies

SKU:
ATL-HPA038520-25
  • Immunohistochemical staining of human prostate shows strong nuclear and cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 65
Gene Name: CCDC65
Alternative Gene Name: CILD27, FAP250, FLJ35732, NYD-SP28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003354: 78%, ENSRNOG00000058916: 76%
Entrez Gene ID: 85478
Uniprot ID: Q8IXS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSVLTPKEQEGIQKNNLEELTEELTKVMVDYIGMENFWKRYNKVKLEQLSLQHRRAQLLDINGKLREMLKQYLDGISVSDEVLSQ
Gene Sequence SSVLTPKEQEGIQKNNLEELTEELTKVMVDYIGMENFWKRYNKVKLEQLSLQHRRAQLLDINGKLREMLKQYLDGISVSDEVLSQ
Gene ID - Mouse ENSMUSG00000003354
Gene ID - Rat ENSRNOG00000058916
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC65 pAb (ATL-HPA038520)
Datasheet Anti CCDC65 pAb (ATL-HPA038520) Datasheet (External Link)
Vendor Page Anti CCDC65 pAb (ATL-HPA038520) at Atlas Antibodies

Documents & Links for Anti CCDC65 pAb (ATL-HPA038520)
Datasheet Anti CCDC65 pAb (ATL-HPA038520) Datasheet (External Link)
Vendor Page Anti CCDC65 pAb (ATL-HPA038520)



Citations for Anti CCDC65 pAb (ATL-HPA038520) – 1 Found
Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535)  PubMed