Anti CCDC65 pAb (ATL-HPA038520)

Atlas Antibodies

Catalog No.: ATL-HPA038520-25

Protein Description: coiled-coil domain containing 65
Gene Name: CCDC65
Alternative Gene Name: CILD27, FAP250, FLJ35732, NYD-SP28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003354: 78%, ENSRNOG00000058916: 76%
Entrez Gene ID: 85478
Uniprot ID: Q8IXS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSVLTPKEQEGIQKNNLEELTEELTKVMVDYIGMENFWKRYNKVKLEQLSLQHRRAQLLDINGKLREMLKQYLDGISVSDEVLSQ
• Gene Sequence: SSVLTPKEQEGIQKNNLEELTEELTKVMVDYIGMENFWKRYNKVKLEQLSLQHRRAQLLDINGKLREMLKQYLDGISVSDEVLSQ
• Gene ID - Mouse: ENSMUSG00000003354
• Gene ID - Rat: ENSRNOG00000058916
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CCDC65 pAb (ATL-HPA038520) – 1 Found

Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535)