Anti CCDC65 pAb (ATL-HPA038520)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038520-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CCDC65
Alternative Gene Name: CILD27, FAP250, FLJ35732, NYD-SP28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003354: 78%, ENSRNOG00000058916: 76%
Entrez Gene ID: 85478
Uniprot ID: Q8IXS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSVLTPKEQEGIQKNNLEELTEELTKVMVDYIGMENFWKRYNKVKLEQLSLQHRRAQLLDINGKLREMLKQYLDGISVSDEVLSQ |
Gene Sequence | SSVLTPKEQEGIQKNNLEELTEELTKVMVDYIGMENFWKRYNKVKLEQLSLQHRRAQLLDINGKLREMLKQYLDGISVSDEVLSQ |
Gene ID - Mouse | ENSMUSG00000003354 |
Gene ID - Rat | ENSRNOG00000058916 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CCDC65 pAb (ATL-HPA038520) | |
Datasheet | Anti CCDC65 pAb (ATL-HPA038520) Datasheet (External Link) |
Vendor Page | Anti CCDC65 pAb (ATL-HPA038520) at Atlas Antibodies |
Documents & Links for Anti CCDC65 pAb (ATL-HPA038520) | |
Datasheet | Anti CCDC65 pAb (ATL-HPA038520) Datasheet (External Link) |
Vendor Page | Anti CCDC65 pAb (ATL-HPA038520) |
Citations for Anti CCDC65 pAb (ATL-HPA038520) – 1 Found |
Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535) PubMed |