Anti CCDC62 pAb (ATL-HPA058741)

Atlas Antibodies

Catalog No.:
ATL-HPA058741-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 62
Gene Name: CCDC62
Alternative Gene Name: CT109, ERAP75, FLJ40344, TSP-NY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061882: 57%, ENSRNOG00000038002: 64%
Entrez Gene ID: 84660
Uniprot ID: Q6P9F0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MERSEISCCQKNEACLGESGMCDSKCCHPSNFIIEAPGHMSDVEWMSIFKPSKMQRIVRLKSGCTCSESICGTQHDSPASELIAIQDSHSLGSSKSALREDETES
Gene Sequence MERSEISCCQKNEACLGESGMCDSKCCHPSNFIIEAPGHMSDVEWMSIFKPSKMQRIVRLKSGCTCSESICGTQHDSPASELIAIQDSHSLGSSKSALREDETES
Gene ID - Mouse ENSMUSG00000061882
Gene ID - Rat ENSRNOG00000038002
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC62 pAb (ATL-HPA058741)
Datasheet Anti CCDC62 pAb (ATL-HPA058741) Datasheet (External Link)
Vendor Page Anti CCDC62 pAb (ATL-HPA058741) at Atlas Antibodies

Documents & Links for Anti CCDC62 pAb (ATL-HPA058741)
Datasheet Anti CCDC62 pAb (ATL-HPA058741) Datasheet (External Link)
Vendor Page Anti CCDC62 pAb (ATL-HPA058741)