Anti CCDC61 pAb (ATL-HPA061548)

Atlas Antibodies

Catalog No.:
ATL-HPA061548-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 61
Gene Name: CCDC61
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074358: 85%, ENSRNOG00000013767: 83%
Entrez Gene ID: 729440
Uniprot ID: Q9Y6R9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FVKAKERKQREIQMKQQQRNRLGSGGSGDGPSVSWSRQTRPPAALTGRGDAPNRSRNRSSSVDSFRSRCSSASSCSDLEDFSESL
Gene Sequence FVKAKERKQREIQMKQQQRNRLGSGGSGDGPSVSWSRQTRPPAALTGRGDAPNRSRNRSSSVDSFRSRCSSASSCSDLEDFSESL
Gene ID - Mouse ENSMUSG00000074358
Gene ID - Rat ENSRNOG00000013767
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC61 pAb (ATL-HPA061548)
Datasheet Anti CCDC61 pAb (ATL-HPA061548) Datasheet (External Link)
Vendor Page Anti CCDC61 pAb (ATL-HPA061548) at Atlas Antibodies

Documents & Links for Anti CCDC61 pAb (ATL-HPA061548)
Datasheet Anti CCDC61 pAb (ATL-HPA061548) Datasheet (External Link)
Vendor Page Anti CCDC61 pAb (ATL-HPA061548)