Anti CCDC6 pAb (ATL-HPA019051 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA019051-25
  • Immunohistochemistry analysis in human fallopian tube and liver tissues using HPA019051 antibody. Corresponding CCDC6 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 6
Gene Name: CCDC6
Alternative Gene Name: D10S170, H4, PTC, TPC, TST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048701: 100%, ENSRNOG00000024019: 100%
Entrez Gene ID: 8030
Uniprot ID: Q16204
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen FKKIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKI
Gene Sequence FKKIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKI
Gene ID - Mouse ENSMUSG00000048701
Gene ID - Rat ENSRNOG00000024019
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC6 pAb (ATL-HPA019051 w/enhanced validation)
Datasheet Anti CCDC6 pAb (ATL-HPA019051 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCDC6 pAb (ATL-HPA019051 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CCDC6 pAb (ATL-HPA019051 w/enhanced validation)
Datasheet Anti CCDC6 pAb (ATL-HPA019051 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCDC6 pAb (ATL-HPA019051 w/enhanced validation)