Anti CCDC59 pAb (ATL-HPA038555 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038555-25

• 
• 
• 

Protein Description: coiled-coil domain containing 59
Gene Name: CCDC59
Alternative Gene Name: BR22, HSPC128, TAP26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019897: 53%, ENSRNOG00000004183: 61%
Entrez Gene ID: 29080
Uniprot ID: Q9P031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLKHLYLAEEERHRKQARKVDHPLSEQVHQPLLEEQCSIDEPLFEDQCSFDQPQPEEQCIKTVNSFTIPKK
• Gene Sequence: NLKHLYLAEEERHRKQARKVDHPLSEQVHQPLLEEQCSIDEPLFEDQCSFDQPQPEEQCIKTVNSFTIPKK
• Gene ID - Mouse: ENSMUSG00000019897
• Gene ID - Rat: ENSRNOG00000004183
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.