Anti CCDC57 pAb (ATL-HPA023315)

Atlas Antibodies

SKU: ATL-HPA023315-25

• 
• 

Protein Description: coiled-coil domain containing 57
Gene Name: CCDC57
Alternative Gene Name: FLJ00130, FLJ23754
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048445: 68%, ENSRNOG00000047531: 71%
Entrez Gene ID: 284001
Uniprot ID: Q2TAC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTRKKEEETFKRKHEELDRLAREKDAVLVAVKGAHVEQLQELQTRVLELQAHCETLEAQLRRAEWRQADTAKEKDAAIDQLREDA
• Gene Sequence: LTRKKEEETFKRKHEELDRLAREKDAVLVAVKGAHVEQLQELQTRVLELQAHCETLEAQLRRAEWRQADTAKEKDAAIDQLREDA
• Gene ID - Mouse: ENSMUSG00000048445
• Gene ID - Rat: ENSRNOG00000047531
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.