Anti CCDC50 pAb (ATL-HPA001336 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA001336-25

• 
• 
• 

Protein Description: coiled-coil domain containing 50
Gene Name: CCDC50
Alternative Gene Name: C3orf6, DFNA44, Ymer
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038127: 84%, ENSRNOG00000001930: 81%
Entrez Gene ID: 152137
Uniprot ID: Q8IVM0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRAYADSYYYEDGGMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQVAQDEEIARLLMAEEKKAYKKAKEREKSSLDKRKQDPEWKPKTAKAANSKSKESDE
• Gene Sequence: QEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRAYADSYYYEDGGMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQVAQDEEIARLLMAEEKKAYKKAKEREKSSLDKRKQDPEWKPKTAKAANSKSKESDE
• Gene ID - Mouse: ENSMUSG00000038127
• Gene ID - Rat: ENSRNOG00000001930
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CCDC50 pAb (ATL-HPA001336 w/enhanced validation) – 1 Found

Farfsing, A; Engel, F; Seiffert, M; Hartmann, E; Ott, G; Rosenwald, A; Stilgenbauer, S; Döhner, H; Boutros, M; Lichter, P; Pscherer, A. Gene knockdown studies revealed CCDC50 as a candidate gene in mantle cell lymphoma and chronic lymphocytic leukemia. Leukemia. 2009;23(11):2018-26.