Anti CCDC43 pAb (ATL-HPA023391)

Atlas Antibodies

Catalog No.:
ATL-HPA023391-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 43
Gene Name: CCDC43
Alternative Gene Name: FLJ31795
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020925: 87%, ENSRNOG00000002748: 92%
Entrez Gene ID: 124808
Uniprot ID: Q96MW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGATTMNIGSDKLLFRNTNVEDVLNARKLERDSLRDESQRKKEQDKLQRERDKLAKQERKE
Gene Sequence SGATTMNIGSDKLLFRNTNVEDVLNARKLERDSLRDESQRKKEQDKLQRERDKLAKQERKE
Gene ID - Mouse ENSMUSG00000020925
Gene ID - Rat ENSRNOG00000002748
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC43 pAb (ATL-HPA023391)
Datasheet Anti CCDC43 pAb (ATL-HPA023391) Datasheet (External Link)
Vendor Page Anti CCDC43 pAb (ATL-HPA023391) at Atlas Antibodies

Documents & Links for Anti CCDC43 pAb (ATL-HPA023391)
Datasheet Anti CCDC43 pAb (ATL-HPA023391) Datasheet (External Link)
Vendor Page Anti CCDC43 pAb (ATL-HPA023391)