Anti CCDC43 pAb (ATL-HPA023391)

Atlas Antibodies

SKU: ATL-HPA023391-25

• 
• 
• 

Protein Description: coiled-coil domain containing 43
Gene Name: CCDC43
Alternative Gene Name: FLJ31795
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020925: 87%, ENSRNOG00000002748: 92%
Entrez Gene ID: 124808
Uniprot ID: Q96MW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGATTMNIGSDKLLFRNTNVEDVLNARKLERDSLRDESQRKKEQDKLQRERDKLAKQERKE
• Gene Sequence: SGATTMNIGSDKLLFRNTNVEDVLNARKLERDSLRDESQRKKEQDKLQRERDKLAKQERKE
• Gene ID - Mouse: ENSMUSG00000020925
• Gene ID - Rat: ENSRNOG00000002748
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.