Anti CCDC40 pAb (ATL-HPA022974 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA022974-25

• 
• 

Protein Description: coiled-coil domain containing 40
Gene Name: CCDC40
Alternative Gene Name: CILD15, FAP172, FLJ20753, FLJ32021, KIAA1640
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098639: 37%, ENSRNOG00000052051: 35%
Entrez Gene ID: 55036
Uniprot ID: Q4G0X9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SEGEKEGNNESHMVSPPEKDDGQKGEEAVGSTEHPEEVTTQAEAAIEEGEVETEGEAAVEGEEEAVSYGDAESEEEYYYTETSSPE
• Gene Sequence: SEGEKEGNNESHMVSPPEKDDGQKGEEAVGSTEHPEEVTTQAEAAIEEGEVETEGEAAVEGEEEAVSYGDAESEEEYYYTETSSPE
• Gene ID - Mouse: ENSMUSG00000098639
• Gene ID - Rat: ENSRNOG00000052051
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CCDC40 pAb (ATL-HPA022974 w/enhanced validation) – 1 Found

Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535)