Anti CCDC39 pAb (ATL-HPA035364 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035364-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CCDC39
Alternative Gene Name: CILD14, DKFZp434A128, FAP59
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027676: 79%, ENSRNOG00000011440: 81%
Entrez Gene ID: 339829
Uniprot ID: Q9UFE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ILDNELTETISAQLELDKAAQDFRKIHNERQELIKQWENTIEQMQKRDGDIDNCALELARIKQETREKENLVKEKIKFLESEIGNNTEFEKRISVADR |
| Gene Sequence | ILDNELTETISAQLELDKAAQDFRKIHNERQELIKQWENTIEQMQKRDGDIDNCALELARIKQETREKENLVKEKIKFLESEIGNNTEFEKRISVADR |
| Gene ID - Mouse | ENSMUSG00000027676 |
| Gene ID - Rat | ENSRNOG00000011440 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCDC39 pAb (ATL-HPA035364 w/enhanced validation) | |
| Datasheet | Anti CCDC39 pAb (ATL-HPA035364 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CCDC39 pAb (ATL-HPA035364 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CCDC39 pAb (ATL-HPA035364 w/enhanced validation) | |
| Datasheet | Anti CCDC39 pAb (ATL-HPA035364 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CCDC39 pAb (ATL-HPA035364 w/enhanced validation) |
| Citations for Anti CCDC39 pAb (ATL-HPA035364 w/enhanced validation) – 6 Found |
| Merveille, Anne-Christine; Davis, Erica E; Becker-Heck, Anita; Legendre, Marie; Amirav, Israel; Bataille, Géraldine; Belmont, John; Beydon, Nicole; Billen, Frédéric; Clément, Annick; Clercx, Cécile; Coste, André; Crosbie, Rachelle; de Blic, Jacques; Deleuze, Stephane; Duquesnoy, Philippe; Escalier, Denise; Escudier, Estelle; Fliegauf, Manfred; Horvath, Judith; Hill, Kent; Jorissen, Mark; Just, Jocelyne; Kispert, Andreas; Lathrop, Mark; Loges, Niki Tomas; Marthin, June K; Momozawa, Yukihide; Montantin, Guy; Nielsen, Kim G; Olbrich, Heike; Papon, Jean-François; Rayet, Isabelle; Roger, Gilles; Schmidts, Miriam; Tenreiro, Henrique; Towbin, Jeffrey A; Zelenika, Diana; Zentgraf, Hanswalter; Georges, Michel; Lequarré, Anne-Sophie; Katsanis, Nicholas; Omran, Heymut; Amselem, Serge. CCDC39 is required for assembly of inner dynein arms and the dynein regulatory complex and for normal ciliary motility in humans and dogs. Nature Genetics. 2011;43(1):72-8. PubMed |
| Tarkar, Aarti; Loges, Niki T; Slagle, Christopher E; Francis, Richard; Dougherty, Gerard W; Tamayo, Joel V; Shook, Brett; Cantino, Marie; Schwartz, Daniel; Jahnke, Charlotte; Olbrich, Heike; Werner, Claudius; Raidt, Johanna; Pennekamp, Petra; Abouhamed, Marouan; Hjeij, Rim; Köhler, Gabriele; Griese, Matthias; Li, You; Lemke, Kristi; Klena, Nikolas; Liu, Xiaoqin; Gabriel, George; Tobita, Kimimasa; Jaspers, Martine; Morgan, Lucy C; Shapiro, Adam J; Letteboer, Stef J F; Mans, Dorus A; Carson, Johnny L; Leigh, Margaret W; Wolf, Whitney E; Chen, Serafine; Lucas, Jane S; Onoufriadis, Alexandros; Plagnol, Vincent; Schmidts, Miriam; Boldt, Karsten; Roepman, Ronald; Zariwala, Maimoona A; Lo, Cecilia W; Mitchison, Hannah M; Knowles, Michael R; Burdine, Rebecca D; Loturco, Joseph J; Omran, Heymut. DYX1C1 is required for axonemal dynein assembly and ciliary motility. Nature Genetics. 2013;45(9):995-1003. PubMed |
| Luscher, Alexandre; Fröhlich, Florian; Barisch, Caroline; Littlewood, Clare; Metcalfe, Joe; Leuba, Florence; Palma, Anita; Pirruccello, Michelle; Cesareni, Gianni; Stagi, Massimiliano; Walther, Tobias C; Soldati, Thierry; De Camilli, Pietro; Swan, Laura E. Lowe syndrome-linked endocytic adaptors direct membrane cycling kinetics with OCRL in Dictyostelium discoideum. Molecular Biology Of The Cell. 2019;30(17):2268-2282. PubMed |
| Emmert, A Scott; Iwasawa, Eri; Shula, Crystal; Schultz, Preston; Lindquist, Diana; Dunn, R Scott; Fugate, Elizabeth M; Hu, Yueh-Chiang; Mangano, Francesco T; Goto, June. Impaired neural differentiation and glymphatic CSF flow in the Ccdc39 rat model of neonatal hydrocephalus: genetic interaction with L1cam. Disease Models & Mechanisms. 2019;12(11) PubMed |
| Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535) PubMed |
| Shi, Xiao; Geng, Hao; Yu, Hui; Hu, Xiaolong; Wang, Guanxiong; Yang, Jin; Zhao, Hui. Biallelic Variants in CCDC39 Gene Lead to Primary Ciliary Dyskinesia and Kartagener Syndrome. Biomed Research International. 2022( 35795318):7130555. PubMed |