Anti CCDC39 pAb (ATL-HPA035363 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA035363-25

• 

Protein Description: coiled-coil domain containing 39
Gene Name: CCDC39
Alternative Gene Name: CILD14, DKFZp434A128, FAP59
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027676: 83%, ENSRNOG00000011440: 88%
Entrez Gene ID: 339829
Uniprot ID: Q9UFE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TESEEHFKAIAQRELGRVKDEIQRLENEMASILEKKSDKENGIFKATQKLDGLKCQMNWDQQALEAWLEESAHKDSDALTLQKYAQQDDNKIRAL
• Gene Sequence: TESEEHFKAIAQRELGRVKDEIQRLENEMASILEKKSDKENGIFKATQKLDGLKCQMNWDQQALEAWLEESAHKDSDALTLQKYAQQDDNKIRAL
• Gene ID - Mouse: ENSMUSG00000027676
• Gene ID - Rat: ENSRNOG00000011440
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.