Anti CCDC34 pAb (ATL-HPA037574)

Atlas Antibodies

SKU:
ATL-HPA037574-25
  • Immunohistochemical staining of human cerebral cortex shows moderate nuclear and nuclear membrane positivity in neurons.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoli fibrillar center & nuclear membrane.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 34
Gene Name: CCDC34
Alternative Gene Name: L15, NY-REN-41, RAMA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027160: 68%, ENSRNOG00000005902: 75%
Entrez Gene ID: 91057
Uniprot ID: Q96HJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEEDVDEDAHDSEAKVASLRGMELQGCASTQVESENNQEEQKQVRLPESRLTPWEVWFIGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAEEK
Gene Sequence DEEDVDEDAHDSEAKVASLRGMELQGCASTQVESENNQEEQKQVRLPESRLTPWEVWFIGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAEEK
Gene ID - Mouse ENSMUSG00000027160
Gene ID - Rat ENSRNOG00000005902
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC34 pAb (ATL-HPA037574)
Datasheet Anti CCDC34 pAb (ATL-HPA037574) Datasheet (External Link)
Vendor Page Anti CCDC34 pAb (ATL-HPA037574) at Atlas Antibodies

Documents & Links for Anti CCDC34 pAb (ATL-HPA037574)
Datasheet Anti CCDC34 pAb (ATL-HPA037574) Datasheet (External Link)
Vendor Page Anti CCDC34 pAb (ATL-HPA037574)