Anti CCDC34 pAb (ATL-HPA037574)

Atlas Antibodies

SKU: ATL-HPA037574-25

• 
• 
• 

Protein Description: coiled-coil domain containing 34
Gene Name: CCDC34
Alternative Gene Name: L15, NY-REN-41, RAMA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027160: 68%, ENSRNOG00000005902: 75%
Entrez Gene ID: 91057
Uniprot ID: Q96HJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEEDVDEDAHDSEAKVASLRGMELQGCASTQVESENNQEEQKQVRLPESRLTPWEVWFIGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAEEK
• Gene Sequence: DEEDVDEDAHDSEAKVASLRGMELQGCASTQVESENNQEEQKQVRLPESRLTPWEVWFIGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAEEK
• Gene ID - Mouse: ENSMUSG00000027160
• Gene ID - Rat: ENSRNOG00000005902
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.