Anti CCDC30 pAb (ATL-HPA036344)

Atlas Antibodies

SKU: ATL-HPA036344-25

• 

Protein Description: coiled-coil domain containing 30
Gene Name: CCDC30
Alternative Gene Name: FLJ20972, LOC728621, PFD6L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028637: 53%, ENSRNOG00000020107: 31%
Entrez Gene ID: 728621
Uniprot ID: Q5VVM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LIACDLLQRENSELETKVLKLSQEFAQLNHFTLGGKTAPSNLITSENTCKDPESNEPILETEIQSRKEETEELCPKLGERKQKEI
• Gene Sequence: LIACDLLQRENSELETKVLKLSQEFAQLNHFTLGGKTAPSNLITSENTCKDPESNEPILETEIQSRKEETEELCPKLGERKQKEI
• Gene ID - Mouse: ENSMUSG00000028637
• Gene ID - Rat: ENSRNOG00000020107
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.