Anti CCDC30 pAb (ATL-HPA036344)

Atlas Antibodies

SKU:
ATL-HPA036344-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 30
Gene Name: CCDC30
Alternative Gene Name: FLJ20972, LOC728621, PFD6L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028637: 53%, ENSRNOG00000020107: 31%
Entrez Gene ID: 728621
Uniprot ID: Q5VVM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LIACDLLQRENSELETKVLKLSQEFAQLNHFTLGGKTAPSNLITSENTCKDPESNEPILETEIQSRKEETEELCPKLGERKQKEI
Gene Sequence LIACDLLQRENSELETKVLKLSQEFAQLNHFTLGGKTAPSNLITSENTCKDPESNEPILETEIQSRKEETEELCPKLGERKQKEI
Gene ID - Mouse ENSMUSG00000028637
Gene ID - Rat ENSRNOG00000020107
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC30 pAb (ATL-HPA036344)
Datasheet Anti CCDC30 pAb (ATL-HPA036344) Datasheet (External Link)
Vendor Page Anti CCDC30 pAb (ATL-HPA036344) at Atlas Antibodies

Documents & Links for Anti CCDC30 pAb (ATL-HPA036344)
Datasheet Anti CCDC30 pAb (ATL-HPA036344) Datasheet (External Link)
Vendor Page Anti CCDC30 pAb (ATL-HPA036344)