Anti CCDC28B pAb (ATL-HPA028589)

Atlas Antibodies

SKU:
ATL-HPA028589-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 28B
Gene Name: CCDC28B
Alternative Gene Name: MGC1203, RP4-622L5.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051375: 27%, ENSRNOG00000020261: 29%
Entrez Gene ID: 79140
Uniprot ID: Q9BUN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEDLSNSMYPFQGTRLCVCVPERSVSSSPALQEYSHTTNFPTSCSPVRFSHRLPKPRYRNLEFP
Gene Sequence LEDLSNSMYPFQGTRLCVCVPERSVSSSPALQEYSHTTNFPTSCSPVRFSHRLPKPRYRNLEFP
Gene ID - Mouse ENSMUSG00000051375
Gene ID - Rat ENSRNOG00000020261
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC28B pAb (ATL-HPA028589)
Datasheet Anti CCDC28B pAb (ATL-HPA028589) Datasheet (External Link)
Vendor Page Anti CCDC28B pAb (ATL-HPA028589) at Atlas Antibodies

Documents & Links for Anti CCDC28B pAb (ATL-HPA028589)
Datasheet Anti CCDC28B pAb (ATL-HPA028589) Datasheet (External Link)
Vendor Page Anti CCDC28B pAb (ATL-HPA028589)