Anti CCDC25 pAb (ATL-HPA023256)

Atlas Antibodies

SKU: ATL-HPA023256-100

• 
• 
• 

Protein Description: coiled-coil domain containing 25
Gene Name: CCDC25
Alternative Gene Name: FLJ10853
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022035: 93%, ENSRNOG00000015939: 92%
Entrez Gene ID: 55246
Uniprot ID: Q86WR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSAYTIYMGKDKYENEDLIKHGWPEDIWFHVDKLSSAHVYLRLHKGENIEDIPKEVLMD
• Gene Sequence: SSAYTIYMGKDKYENEDLIKHGWPEDIWFHVDKLSSAHVYLRLHKGENIEDIPKEVLMD
• Gene ID - Mouse: ENSMUSG00000022035
• Gene ID - Rat: ENSRNOG00000015939
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.