Anti CCDC24 pAb (ATL-HPA035424 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035424-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $447.00
    
         
                            Gene Name: CCDC24
Alternative Gene Name: MGC45441
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078588: 78%, ENSRNOG00000019586: 75%
Entrez Gene ID: 149473
Uniprot ID: Q8N4L8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | SLWELVEEHVPLRERREVKRILGEAAVDLSLELRAEVAMLRALLQEARSSQAPSSRPISDPSSLLAP | 
| Gene Sequence | SLWELVEEHVPLRERREVKRILGEAAVDLSLELRAEVAMLRALLQEARSSQAPSSRPISDPSSLLAP | 
| Gene ID - Mouse | ENSMUSG00000078588 | 
| Gene ID - Rat | ENSRNOG00000019586 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti CCDC24 pAb (ATL-HPA035424 w/enhanced validation) | |
| Datasheet | Anti CCDC24 pAb (ATL-HPA035424 w/enhanced validation) Datasheet (External Link) | 
| Vendor Page | Anti CCDC24 pAb (ATL-HPA035424 w/enhanced validation) at Atlas Antibodies | 
| Documents & Links for Anti CCDC24 pAb (ATL-HPA035424 w/enhanced validation) | |
| Datasheet | Anti CCDC24 pAb (ATL-HPA035424 w/enhanced validation) Datasheet (External Link) | 
| Vendor Page | Anti CCDC24 pAb (ATL-HPA035424 w/enhanced validation) | 
 
         
                             
                                         
                                        