Anti CCDC22 pAb (ATL-HPA000888)

Atlas Antibodies

Catalog No.: ATL-HPA000888-25

Protein Description: coiled-coil domain containing 22
Gene Name: CCDC22
Alternative Gene Name: CXorf37, JM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031143: 87%, ENSRNOG00000010846: 87%
Entrez Gene ID: 28952
Uniprot ID: O60826
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPAGDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEPREFQASPLLLPVPTQVPQPVGRVA
• Gene Sequence: YQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPAGDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEPREFQASPLLLPVPTQVPQPVGRVA
• Gene ID - Mouse: ENSMUSG00000031143
• Gene ID - Rat: ENSRNOG00000010846
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CCDC22 pAb (ATL-HPA000888) – 1 Found

Kolanczyk, Mateusz; Krawitz, Peter; Hecht, Jochen; Hupalowska, Anna; Miaczynska, Marta; Marschner, Katrin; Schlack, Claire; Emmerich, Denise; Kobus, Karolina; Kornak, Uwe; Robinson, Peter N; Plecko, Barbara; Grangl, Gernot; Uhrig, Sabine; Mundlos, Stefan; Horn, Denise. Missense variant in CCDC22 causes X-linked recessive intellectual disability with features of Ritscher-Schinzel/3C syndrome. European Journal Of Human Genetics : Ejhg. 2015;23(5):633-8.