Anti CCDC22 pAb (ATL-HPA000888)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000888-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CCDC22
Alternative Gene Name: CXorf37, JM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031143: 87%, ENSRNOG00000010846: 87%
Entrez Gene ID: 28952
Uniprot ID: O60826
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPAGDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEPREFQASPLLLPVPTQVPQPVGRVA |
| Gene Sequence | YQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPAGDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEPREFQASPLLLPVPTQVPQPVGRVA |
| Gene ID - Mouse | ENSMUSG00000031143 |
| Gene ID - Rat | ENSRNOG00000010846 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CCDC22 pAb (ATL-HPA000888) | |
| Datasheet | Anti CCDC22 pAb (ATL-HPA000888) Datasheet (External Link) |
| Vendor Page | Anti CCDC22 pAb (ATL-HPA000888) at Atlas Antibodies |
| Documents & Links for Anti CCDC22 pAb (ATL-HPA000888) | |
| Datasheet | Anti CCDC22 pAb (ATL-HPA000888) Datasheet (External Link) |
| Vendor Page | Anti CCDC22 pAb (ATL-HPA000888) |
| Citations for Anti CCDC22 pAb (ATL-HPA000888) – 1 Found |
| Kolanczyk, Mateusz; Krawitz, Peter; Hecht, Jochen; Hupalowska, Anna; Miaczynska, Marta; Marschner, Katrin; Schlack, Claire; Emmerich, Denise; Kobus, Karolina; Kornak, Uwe; Robinson, Peter N; Plecko, Barbara; Grangl, Gernot; Uhrig, Sabine; Mundlos, Stefan; Horn, Denise. Missense variant in CCDC22 causes X-linked recessive intellectual disability with features of Ritscher-Schinzel/3C syndrome. European Journal Of Human Genetics : Ejhg. 2015;23(5):633-8. PubMed |