Anti CCDC190 pAb (ATL-HPA028592)

Atlas Antibodies

Catalog No.: ATL-HPA028592-25

Protein Description: coiled-coil domain containing 190
Gene Name: CCDC190
Alternative Gene Name: C1orf110, MGC48998
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070532: 59%, ENSRNOG00000025005: 61%
Entrez Gene ID: 339512
Uniprot ID: Q86UF4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGSFEGEFTKPTFLELLSKARNAHYLRHRVPPESERLLSIGEIFGHGESSSSRAGKECENRVPSKFLPL
• Gene Sequence: AGSFEGEFTKPTFLELLSKARNAHYLRHRVPPESERLLSIGEIFGHGESSSSRAGKECENRVPSKFLPL
• Gene ID - Mouse: ENSMUSG00000070532
• Gene ID - Rat: ENSRNOG00000025005
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.