Anti CCDC190 pAb (ATL-HPA028592)

Atlas Antibodies

SKU:
ATL-HPA028592-25
  • Immunohistochemical staining of human colon shows nuclear positivity in a fraction of basal glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 190
Gene Name: CCDC190
Alternative Gene Name: C1orf110, MGC48998
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070532: 59%, ENSRNOG00000025005: 61%
Entrez Gene ID: 339512
Uniprot ID: Q86UF4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGSFEGEFTKPTFLELLSKARNAHYLRHRVPPESERLLSIGEIFGHGESSSSRAGKECENRVPSKFLPL
Gene Sequence AGSFEGEFTKPTFLELLSKARNAHYLRHRVPPESERLLSIGEIFGHGESSSSRAGKECENRVPSKFLPL
Gene ID - Mouse ENSMUSG00000070532
Gene ID - Rat ENSRNOG00000025005
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC190 pAb (ATL-HPA028592)
Datasheet Anti CCDC190 pAb (ATL-HPA028592) Datasheet (External Link)
Vendor Page Anti CCDC190 pAb (ATL-HPA028592) at Atlas Antibodies

Documents & Links for Anti CCDC190 pAb (ATL-HPA028592)
Datasheet Anti CCDC190 pAb (ATL-HPA028592) Datasheet (External Link)
Vendor Page Anti CCDC190 pAb (ATL-HPA028592)