Anti CCDC189 pAb (ATL-HPA041806 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041806-25
  • Immunohistochemical staining of human nasopharynx shows strong positivity in respiratory epithelial cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and C16orf93 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY423099).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 189
Gene Name: CCDC189
Alternative Gene Name: C16orf93, MGC104706
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057176: 76%, ENSRNOG00000053015: 78%
Entrez Gene ID: 90835
Uniprot ID: A1A4V9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SCLPQFAFFPQPPLPRPRICMWKYLDVHSMHQLEKTTNAEMREVLAELLELGCPEQSLRDAITLDLFCHALIFCRQQGFSL
Gene Sequence SCLPQFAFFPQPPLPRPRICMWKYLDVHSMHQLEKTTNAEMREVLAELLELGCPEQSLRDAITLDLFCHALIFCRQQGFSL
Gene ID - Mouse ENSMUSG00000057176
Gene ID - Rat ENSRNOG00000053015
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CCDC189 pAb (ATL-HPA041806 w/enhanced validation)
Datasheet Anti CCDC189 pAb (ATL-HPA041806 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCDC189 pAb (ATL-HPA041806 w/enhanced validation)