Anti CCDC184 pAb (ATL-HPA041715)

Atlas Antibodies

SKU: ATL-HPA041715-25

• 
• 

Protein Description: coiled-coil domain containing 184
Gene Name: CCDC184
Alternative Gene Name: C12orf68, LOC387856
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029875: 80%, ENSRNOG00000021945: 82%
Entrez Gene ID: 387856
Uniprot ID: Q52MB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEEKEMPSPATPSSHCERPESPCAGLLGGDGPLVEPLDMPDITLLQLEGEA
• Gene Sequence: EEEKEMPSPATPSSHCERPESPCAGLLGGDGPLVEPLDMPDITLLQLEGEA
• Gene ID - Mouse: ENSMUSG00000029875
• Gene ID - Rat: ENSRNOG00000021945
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.