Anti CCDC183 pAb (ATL-HPA043812)

Atlas Antibodies

SKU:
ATL-HPA043812-25
  • Immunohistochemical staining of human bone marrow shows strong cytoplasmic and nuclear positivity in hematopoietic cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 183
Gene Name: CCDC183
Alternative Gene Name: bA216L13.7, KIAA1984, MGC15438
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026940: 71%, ENSRNOG00000017044: 66%
Entrez Gene ID: 84960
Uniprot ID: Q5T5S1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QELLLTIQMGIDNLYVRLMGITLPATQREVVLSNTLDLNSKLAYCEGKLTYLADRVQMVSRTEEGDTKVRDTLESSTLMEKYNTRISFENRE
Gene Sequence QELLLTIQMGIDNLYVRLMGITLPATQREVVLSNTLDLNSKLAYCEGKLTYLADRVQMVSRTEEGDTKVRDTLESSTLMEKYNTRISFENRE
Gene ID - Mouse ENSMUSG00000026940
Gene ID - Rat ENSRNOG00000017044
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC183 pAb (ATL-HPA043812)
Datasheet Anti CCDC183 pAb (ATL-HPA043812) Datasheet (External Link)
Vendor Page Anti CCDC183 pAb (ATL-HPA043812) at Atlas Antibodies

Documents & Links for Anti CCDC183 pAb (ATL-HPA043812)
Datasheet Anti CCDC183 pAb (ATL-HPA043812) Datasheet (External Link)
Vendor Page Anti CCDC183 pAb (ATL-HPA043812)