Anti CCDC182 pAb (ATL-HPA023446)

Atlas Antibodies

Catalog No.:
ATL-HPA023446-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 182
Gene Name: CCDC182
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098681: 79%, ENSRNOG00000010446: 70%
Entrez Gene ID: 101927581
Uniprot ID: A6NF36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDAFCEMNGALVQQEEQAARVRQRLREEEDRGIVRNKVLTFLLPREKQLREHCKRLEDLLLDRGRDALRATKKSQAD
Gene Sequence EDAFCEMNGALVQQEEQAARVRQRLREEEDRGIVRNKVLTFLLPREKQLREHCKRLEDLLLDRGRDALRATKKSQAD
Gene ID - Mouse ENSMUSG00000098681
Gene ID - Rat ENSRNOG00000010446
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC182 pAb (ATL-HPA023446)
Datasheet Anti CCDC182 pAb (ATL-HPA023446) Datasheet (External Link)
Vendor Page Anti CCDC182 pAb (ATL-HPA023446) at Atlas Antibodies

Documents & Links for Anti CCDC182 pAb (ATL-HPA023446)
Datasheet Anti CCDC182 pAb (ATL-HPA023446) Datasheet (External Link)
Vendor Page Anti CCDC182 pAb (ATL-HPA023446)