Anti CCDC18 pAb (ATL-HPA028035)

Atlas Antibodies

SKU:
ATL-HPA028035-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 18
Gene Name: CCDC18
Alternative Gene Name: NY-SAR-41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056531: 85%, ENSRNOG00000024545: 69%
Entrez Gene ID: 343099
Uniprot ID: Q5T9S5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HQVESVKDQNQHTMNKQYEKERQRLVTGIEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKLESEMTKKCSQLLTLEKQLEEKI
Gene Sequence HQVESVKDQNQHTMNKQYEKERQRLVTGIEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKLESEMTKKCSQLLTLEKQLEEKI
Gene ID - Mouse ENSMUSG00000056531
Gene ID - Rat ENSRNOG00000024545
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC18 pAb (ATL-HPA028035)
Datasheet Anti CCDC18 pAb (ATL-HPA028035) Datasheet (External Link)
Vendor Page Anti CCDC18 pAb (ATL-HPA028035) at Atlas Antibodies

Documents & Links for Anti CCDC18 pAb (ATL-HPA028035)
Datasheet Anti CCDC18 pAb (ATL-HPA028035) Datasheet (External Link)
Vendor Page Anti CCDC18 pAb (ATL-HPA028035)