Anti CCDC174 pAb (ATL-HPA043468)

Atlas Antibodies

SKU:
ATL-HPA043468-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 174
Gene Name: CCDC174
Alternative Gene Name: C3orf19, FLJ33839
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034083: 94%, ENSRNOG00000010090: 94%
Entrez Gene ID: 51244
Uniprot ID: Q6PII3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KAELFRKQEEFKQEKLLKDSGVFGKPKTTNKKPSIWSKQNVGVSNRAEKDAEQKIEEQKTLDKAREKLEEKAKLYEKMTKGDFIDEEVEDMYLVDFTQKI
Gene Sequence KAELFRKQEEFKQEKLLKDSGVFGKPKTTNKKPSIWSKQNVGVSNRAEKDAEQKIEEQKTLDKAREKLEEKAKLYEKMTKGDFIDEEVEDMYLVDFTQKI
Gene ID - Mouse ENSMUSG00000034083
Gene ID - Rat ENSRNOG00000010090
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC174 pAb (ATL-HPA043468)
Datasheet Anti CCDC174 pAb (ATL-HPA043468) Datasheet (External Link)
Vendor Page Anti CCDC174 pAb (ATL-HPA043468) at Atlas Antibodies

Documents & Links for Anti CCDC174 pAb (ATL-HPA043468)
Datasheet Anti CCDC174 pAb (ATL-HPA043468) Datasheet (External Link)
Vendor Page Anti CCDC174 pAb (ATL-HPA043468)