Anti CCDC173 pAb (ATL-HPA042995)

Atlas Antibodies

SKU:
ATL-HPA042995-25
  • Immunohistochemical staining of human fallopian tube shows distinct positivity in cilia.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Liver tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 173
Gene Name: CCDC173
Alternative Gene Name: C2orf77, LOC129881
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070883: 74%, ENSRNOG00000052954: 69%
Entrez Gene ID: 129881
Uniprot ID: Q0VFZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TIAEYRAIVMKNKEEEERQRKIEAKEQLLAVMKADQIFWEHEKEKKCKADKEHQEVQDAHIQQMAKNKFNAKQAKQAELDYCRLT
Gene Sequence TIAEYRAIVMKNKEEEERQRKIEAKEQLLAVMKADQIFWEHEKEKKCKADKEHQEVQDAHIQQMAKNKFNAKQAKQAELDYCRLT
Gene ID - Mouse ENSMUSG00000070883
Gene ID - Rat ENSRNOG00000052954
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC173 pAb (ATL-HPA042995)
Datasheet Anti CCDC173 pAb (ATL-HPA042995) Datasheet (External Link)
Vendor Page Anti CCDC173 pAb (ATL-HPA042995) at Atlas Antibodies

Documents & Links for Anti CCDC173 pAb (ATL-HPA042995)
Datasheet Anti CCDC173 pAb (ATL-HPA042995) Datasheet (External Link)
Vendor Page Anti CCDC173 pAb (ATL-HPA042995)