Anti CCDC171 pAb (ATL-HPA019803)

Atlas Antibodies

SKU:
ATL-HPA019803-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 171
Gene Name: CCDC171
Alternative Gene Name: bA536D16.1, bA778P13.1, C9orf93, Em:AL513423.1, FLJ39267, FLJ46740
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052407: 95%, ENSRNOG00000057880: 26%
Entrez Gene ID: 203238
Uniprot ID: Q6TFL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KAQAAQSESELQKLSQAFHKDAEEKLTFLHTLYQHLVAGCVLIKQPEGMLDKFSWSELCAVLQENVDALIADLNRANEKIRHLEYICKNKSDTMREL
Gene Sequence KAQAAQSESELQKLSQAFHKDAEEKLTFLHTLYQHLVAGCVLIKQPEGMLDKFSWSELCAVLQENVDALIADLNRANEKIRHLEYICKNKSDTMREL
Gene ID - Mouse ENSMUSG00000052407
Gene ID - Rat ENSRNOG00000057880
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC171 pAb (ATL-HPA019803)
Datasheet Anti CCDC171 pAb (ATL-HPA019803) Datasheet (External Link)
Vendor Page Anti CCDC171 pAb (ATL-HPA019803) at Atlas Antibodies

Documents & Links for Anti CCDC171 pAb (ATL-HPA019803)
Datasheet Anti CCDC171 pAb (ATL-HPA019803) Datasheet (External Link)
Vendor Page Anti CCDC171 pAb (ATL-HPA019803)