Anti CCDC17 pAb (ATL-HPA028338 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA028338-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 17
Gene Name: CCDC17
Alternative Gene Name: FLJ33084
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034035: 64%, ENSRNOG00000023216: 61%
Entrez Gene ID: 149483
Uniprot ID: Q96LX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REAELYSPVQKANPGTLAAEIRALREAYIRDGGRDPGVLGQIWQLQVEASALELQRSQTRRGRAGATSGELPVVEAENRRLEAEILALQMQR
Gene Sequence REAELYSPVQKANPGTLAAEIRALREAYIRDGGRDPGVLGQIWQLQVEASALELQRSQTRRGRAGATSGELPVVEAENRRLEAEILALQMQR
Gene ID - Mouse ENSMUSG00000034035
Gene ID - Rat ENSRNOG00000023216
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CCDC17 pAb (ATL-HPA028338 w/enhanced validation)
Datasheet Anti CCDC17 pAb (ATL-HPA028338 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCDC17 pAb (ATL-HPA028338 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CCDC17 pAb (ATL-HPA028338 w/enhanced validation)
Datasheet Anti CCDC17 pAb (ATL-HPA028338 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CCDC17 pAb (ATL-HPA028338 w/enhanced validation)