Anti CCDC17 pAb (ATL-HPA028338 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA028338-25

• 

Protein Description: coiled-coil domain containing 17
Gene Name: CCDC17
Alternative Gene Name: FLJ33084
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034035: 64%, ENSRNOG00000023216: 61%
Entrez Gene ID: 149483
Uniprot ID: Q96LX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REAELYSPVQKANPGTLAAEIRALREAYIRDGGRDPGVLGQIWQLQVEASALELQRSQTRRGRAGATSGELPVVEAENRRLEAEILALQMQR
• Gene Sequence: REAELYSPVQKANPGTLAAEIRALREAYIRDGGRDPGVLGQIWQLQVEASALELQRSQTRRGRAGATSGELPVVEAENRRLEAEILALQMQR
• Gene ID - Mouse: ENSMUSG00000034035
• Gene ID - Rat: ENSRNOG00000023216
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.