Anti CCDC168 pAb (ATL-HPA058793)

Atlas Antibodies

SKU:
ATL-HPA058793-25
  • Immunohistochemical staining of human heart muscle shows strong cytoplasmic and membranous positivity in myocytes.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coiled-coil domain containing 168
Gene Name: CCDC168
Alternative Gene Name: C13orf40, FLJ40176
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091844: 57%, ENSRNOG00000023089: 50%
Entrez Gene ID: 643677
Uniprot ID: Q8NDH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPPSCKSHKSRKYRSSSKMKSPDWLCHSSSNTAEIQSRSSSVSFSEEKISWTTKSRTSYSSAPLTESNIKSHLAKNQGKSHRHPESQERKKARSDLFRK
Gene Sequence TPPSCKSHKSRKYRSSSKMKSPDWLCHSSSNTAEIQSRSSSVSFSEEKISWTTKSRTSYSSAPLTESNIKSHLAKNQGKSHRHPESQERKKARSDLFRK
Gene ID - Mouse ENSMUSG00000091844
Gene ID - Rat ENSRNOG00000023089
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCDC168 pAb (ATL-HPA058793)
Datasheet Anti CCDC168 pAb (ATL-HPA058793) Datasheet (External Link)
Vendor Page Anti CCDC168 pAb (ATL-HPA058793) at Atlas Antibodies

Documents & Links for Anti CCDC168 pAb (ATL-HPA058793)
Datasheet Anti CCDC168 pAb (ATL-HPA058793) Datasheet (External Link)
Vendor Page Anti CCDC168 pAb (ATL-HPA058793)